Cagrilintide Description
Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Peptide Information
| Value |
|---|
| XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| C194H312N54O59S2 |
| 4409 g/mol |
| 1415456-99-3 |
| 171397054 |
| 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
Cagrilintide Peptide Structure
Source: PubChem
Lyophilized Peptides:
Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
