FOXO4-DRI Peptide Description
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.
Peptide Information
| Value |
|---|
| LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids) |
| C228H388N86O64 |
| 5358 g/mol |
| 2460055-10-9 |
| Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431 |
FOXO4-D-Retro-Inverso Structure
Source: Uniprot
